PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00008696001
Common NameGSBRNA2T00008696001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LFY
Protein Properties Length: 412aa    MW: 45766.5 Da    PI: 7.1195
Description LFY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00008696001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FLO_LFY616.35.8e-18813881386
              FLO_LFY   1 mdpeafsaslfkwdpraaaaapparlleeaavseapleaaaaaaarklreleelfkayGvryltvakiaelGftvstLvdmkdeelddlm 90 
                          mdpe f++ lf+w+p  +++++p+ + + +++s+a  + ++aa  ++l +le lf  yGvr++t+akiaelGft+stLv+mkdeel+d+m
  GSBRNA2T00008696001   1 MDPEGFTSGLFRWNPTRVMVQAPTPIPPPQQQSPA--TPQTAAFGMRLGGLEGLFGPYGVRFYTAAKIAELGFTASTLVGMKDEELEDMM 88 
                          9*************999998888888776654443..467777788899***************************************** PP

              FLO_LFY  91 kslseifrldllvGeryGikaavraerrrlee..eeaekkrrkll...sedeet..aldalsqeglseepvqeekeaagsggeglgeael 173
                          +sls+ifr++llvGeryGikaavraerrrl+e  ee++++rr+ll   + d+ t  aldalsqegls+epvq++ ++ ++g +g g+ + 
  GSBRNA2T00008696001  89 NSLSHIFRWELLVGERYGIKAAVRAERRRLQEeeEEESSRRRHLLlsaAGDSGThlALDALSQEGLSQEPVQHQDQTDAAGINGGGRGGY 178
                          ******************************995444567778877787455544569**************9976655555555445555 PP

              FLO_LFY 174 vaaeekkseeekkkaskkkqkrkkkkelkseededeeeeededeeg...sgedgeerqrehPfivtepgevargkknGLDYLfdLyeqCr 260
                            a ++   + kk++ + ++++k   + + e+d+d +e ed+d+++   ++ +g+erqrehPfivtepgevargkknGLDYLf+LyeqCr
  GSBRNA2T00008696001 179 WEAGQT---TIKKQQ-Q-RRRKKAIVT-SVETDDDGNEGEDDDGMDivnGSGSGMERQREHPFIVTEPGEVARGKKNGLDYLFHLYEQCR 262
                          544422...222222.2.233333333.334444444444444444343667799*********************************** PP

              FLO_LFY 261 efLlqvqkiakerGekcPtkvtnqvfryakkagasyinkPkmrhYvhCYalhcLdeeasnalrrafkergenvGawrqacykplvaiaar 350
                          efLlqvq+iak+rGekcPtkvtnqvfryakk+ga+yinkPkmrhYvhCYalhcLdeeasnalrrafkergenvG+wrqacykplv+ia r
  GSBRNA2T00008696001 263 EFLLQVQTIAKDRGEKCPTKVTNQVFRYAKKSGANYINKPKMRHYVHCYALHCLDEEASNALRRAFKERGENVGSWRQACYKPLVDIACR 352
                          ****************************************************************************************** PP

              FLO_LFY 351 qgwdidavfnahprLsiWYvPtkLrqLChlerskas 386
                          +gwdidavfnahprLsiWYvPtkLrqLChler++a+
  GSBRNA2T00008696001 353 HGWDIDAVFNAHPRLSIWYVPTKLRQLCHLERNNAV 388
                          ********************************9975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF016981.2E-1971387IPR002910Floricaula/leafy protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010582Biological Processfloral meristem determinacy
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0031490Molecular Functionchromatin DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0043621Molecular Functionprotein self-association
Sequence ? help Back to Top
Protein Sequence    Length: 412 aa     Download sequence    Send to blast
MDPEGFTSGL FRWNPTRVMV QAPTPIPPPQ QQSPATPQTA AFGMRLGGLE GLFGPYGVRF  60
YTAAKIAELG FTASTLVGMK DEELEDMMNS LSHIFRWELL VGERYGIKAA VRAERRRLQE  120
EEEEESSRRR HLLLSAAGDS GTHLALDALS QEGLSQEPVQ HQDQTDAAGI NGGGRGGYWE  180
AGQTTIKKQQ QRRRKKAIVT SVETDDDGNE GEDDDGMDIV NGSGSGMERQ REHPFIVTEP  240
GEVARGKKNG LDYLFHLYEQ CREFLLQVQT IAKDRGEKCP TKVTNQVFRY AKKSGANYIN  300
KPKMRHYVHC YALHCLDEEA SNALRRAFKE RGENVGSWRQ ACYKPLVDIA CRHGWDIDAV  360
FNAHPRLSIW YVPTKLRQLC HLERNNAVAA AATLVGGISC EGSPASGRFG V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2vy1_A1e-1272264112187PROTEIN LEAFY
2vy2_A1e-1272264112187PROTEIN LEAFY
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00095SELEXTransfer from AT5G61850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankZ183620.0Z18362.1 Brassica oleracea gene encoding BOFH.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013627202.10.0PREDICTED: putative transcription factor BOFH isoform X2
SwissprotQ009580.0LFY_ARATH; Protein LEAFY
TrEMBLA0A078IPZ10.0A0A078IPZ1_BRANA; BnaCnng24550D protein
STRINGBra019619.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM79072841
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G61850.10.0floral meristem identity control protein LEAFY (LFY)
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]